Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adhesion G protein-coupled receptor F5 (ADGRF5), partial

Product Specifications

Product Name Alternative

G-protein coupled receptor 116

Abbreviation

Recombinant Human ADGRF5 protein, partial

Gene Name

ADGRF5

UniProt

Q8IZF2

Expression Region

227-565aa

Organism

Homo sapiens (Human)

Target Sequence

SVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVCKLILDIFEYECKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDIDSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPISVSEGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWNGTYHCIFRYKNSYSIATKDVIVHPL

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor that plays a critical role in lung surfactant homeostasis. May play a role in controlling adipocyte function.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse TIM3, FITC, (clone: 25F.1D6), (rat IgG2ak)
MBS520440-01 0.1 mg

Anti-Mouse TIM3, FITC, (clone: 25F.1D6), (rat IgG2ak)

Sign In for Pricing
View Details
Anti-Mouse TIM3, FITC, (clone: 25F.1D6), (rat IgG2ak)
MBS520440-02 5x 0.1 mg

Anti-Mouse TIM3, FITC, (clone: 25F.1D6), (rat IgG2ak)

Sign In for Pricing
View Details
TANK Recombinant Protein Antigen
NBP2-38358PEP 0.1 mL

TANK Recombinant Protein Antigen

Sign In for Pricing
View Details
Box of 100 folded fast qualitative filter, 400 mm
QL02P0400 Box of 100

Box of 100 folded fast qualitative filter, 400 mm

Sign In for Pricing
View Details
Human Synaptopodin ELISA Kit
ELA-E9889h 96 Tests

Human Synaptopodin ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Dapk2 shRNA (UAS) - Lentiviral mouse Dapk2 shRNA (UAS, RFP) (25)
GTR15191615 1 Vial

Lentiviral mouse Dapk2 shRNA (UAS) - Lentiviral mouse Dapk2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details