Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Human (His)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein's involvement in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uch-l3-protein-human-his.html

Purity

98.0

Smiles

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

7347 (Gene_ID) P15374 (M1-A230) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

L3MBTL1 (Lethal (3) Malignant Brain Tumor-like Protein 1, H-l (3) mbt, H-l (3) mbt Protein, L (3) mbt-like, L (3) mbt Protein Homolog, L3MBTL1, L3MBTL1, KIAA0681, L3MBT, L3MBTL) (MaxLight 650) discontinued
302522-ML650 100 µL

L3MBTL1 (Lethal (3) Malignant Brain Tumor-like Protein 1, H-l (3) mbt, H-l (3) mbt Protein, L (3) mbt-like, L (3) mbt Protein Homolog, L3MBTL1, L3MBTL1, KIAA0681, L3MBT, L3MBTL) (MaxLight 650) discontinued

Ask
View Details
ZNF571 Human shRNA Plasmid Kit (Locus ID 51276)
TL300126 1 Kit

ZNF571 Human shRNA Plasmid Kit (Locus ID 51276)

Ask
View Details
Lentiviral mouse Taf1 shRNA (UAS) - Lentiviral mouse Taf1 shRNA (UAS, iRFP) (25)
GTR15177566 1 Vial

Lentiviral mouse Taf1 shRNA (UAS) - Lentiviral mouse Taf1 shRNA (UAS, iRFP) (25)

Ask
View Details