Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Human (His)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein's involvement in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uch-l3-protein-human-his.html

Purity

98.0

Smiles

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

7347 (Gene_ID) P15374 (M1-A230) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Phospholipase A2 Receptor 1 (PLA2R1) ELISA kit
YLA0870HU-01 48 Tests

Human Phospholipase A2 Receptor 1 (PLA2R1) ELISA kit

Ask
View Details
Human Phospholipase A2 Receptor 1 (PLA2R1) ELISA kit
YLA0870HU-02 96 Tests

Human Phospholipase A2 Receptor 1 (PLA2R1) ELISA kit

Ask
View Details
Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (MaxLight 405)
MBS6504886-01 0.1 mL

Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (MaxLight 405)

Ask
View Details
Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (MaxLight 405)
MBS6504886-02 5x 0.1 mL

Uridine Monophosphate Kinase 2, NT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (MaxLight 405)

Ask
View Details
PRDM5 (NM_018699) Human Over-expression Lysate
LY412894 100 µg

PRDM5 (NM_018699) Human Over-expression Lysate

Ask
View Details
OTOA, NT (OTOA, Otoancorin) (AP)
MBS6329801-01 0.2 mL

OTOA, NT (OTOA, Otoancorin) (AP)

Ask
View Details