Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Human (His)

IL-36RN protein tightly regulates immunity by inhibiting the activity of interleukin 36 (IL36A, IL36B, IL36G) .It binds to the IL-36 receptor (IL1RL2), preventing binding to IL1RAP and blocking downstream signaling.Animal-Free IL-36RN Protein, Human (His) is the recombinant human-derived animal-FreeIL-36RN protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-human-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLT

Molecular Formula

26525 (Gene_ID) Q9UBH0 (M1-T108) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK1 (Ab-174) Antibody
E021191-1 50 µg - 50 µL

AMPK1 (Ab-174) Antibody

Sign In for Pricing
View Details
HHLA2 Rabbit Polyclonal Antibody (HRP)
orb467669 100 µL

HHLA2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
QPCR Kit DNA Fungi Kingd Mmix
MOL6912 1 Each

QPCR Kit DNA Fungi Kingd Mmix

Sign In for Pricing
View Details
Human Itgam/CD11b ELISA Kit
MBS8427207 Inquire

Human Itgam/CD11b ELISA Kit

Sign In for Pricing
View Details
LPCAT1 Protein Vector (Rat) (pPM-C-HA)
PV279740 500 ng

LPCAT1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
IDH3B (Isocitrate Dehydrogenase [NAD] Subunit beta, Mitochondrial, Isocitric Dehydrogenase Subunit beta NAD (+) -specific ICDH Subunit beta) (FITC)
319740-01 50 µg

IDH3B (Isocitrate Dehydrogenase [NAD] Subunit beta, Mitochondrial, Isocitric Dehydrogenase Subunit beta NAD (+) -specific ICDH Subunit beta) (FITC)

Sign In for Pricing
View Details