G-CSF, Rat (HEK293)
G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.
Product Specifications
Product Name Alternative
G-CSF Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/g-csf-protein-rat-hek293.html
Purity
95.00
Smiles
IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Molecular Formula
25610 (Gene_ID) P97712 (I22-I214) (Accession)
Molecular Weight
Approximately 27-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Aliper AM, et al. A role for G-CSF and GM-CSF in nonmyeloid cancers. Cancer Med. 2014 Aug;3 (4) :737-46.|[2]Wright CR, et al. Granulocyte Colony-Stimulating Factor and Its Potential Application for Skeletal Muscle Repair and Regeneration. Mediators Inflamm. 2017;2017:7517350.|[3]Liu M, et al. The Effect of Granulocyte Colony-Stimulating Factor on the Progression of Atherosclerosis in Animal Models: A Meta-Analysis. Biomed Res Int. 2017;2017:6705363.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP15147PU-N 400 µL
PKR (EIF2AK2) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNCB1902-500 1x 500 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details