Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Rat (HEK293)

G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.

Product Specifications

Product Name Alternative

G-CSF Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-rat-hek293.html

Purity

95.00

Smiles

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Molecular Formula

25610 (Gene_ID) P97712 (I22-I214) (Accession)

Molecular Weight

Approximately 27-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Aliper AM, et al. A role for G-CSF and GM-CSF in nonmyeloid cancers. Cancer Med. 2014 Aug;3 (4) :737-46.|[2]Wright CR, et al. Granulocyte Colony-Stimulating Factor and Its Potential Application for Skeletal Muscle Repair and Regeneration. Mediators Inflamm. 2017;2017:7517350.|[3]Liu M, et al. The Effect of Granulocyte Colony-Stimulating Factor on the Progression of Atherosclerosis in Animal Models: A Meta-Analysis. Biomed Res Int. 2017;2017:6705363.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB25 HDR Plasmid (m)
sc-430976-HDR 20 µg

ZBTB25 HDR Plasmid (m)

Sign In for Pricing
View Details
Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit
MBS743488-01 48 Well

Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit

Sign In for Pricing
View Details
Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit
MBS743488-02 96 Well

Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit

Sign In for Pricing
View Details
Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit
MBS743488-03 5x 96 Well

Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit

Sign In for Pricing
View Details
Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit
MBS743488-04 10x 96 Well

Canine Ultrasensitive thyroid-stimulating hormone ELISA Kit

Sign In for Pricing
View Details
PRSS42 Polyclonal Antibody, Cy5.5 Conjugated
bs-24113R-Cy5.5 100 µL

PRSS42 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details