Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6E (Ly6e)

Product Specifications

Product Name Alternative

Ly-6E; Stem cell antigen 2; Thymic shared antigen 1; TSA-1

Abbreviation

Recombinant Mouse Ly6e protein

Gene Name

Ly6e

UniProt

Q64253

Expression Region

27-108aa

Organism

Mus musculus (Mouse)

Target Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of murine coronavirus, mouse hepatitis virus, by interfering with spike protein-mediated membrane fusion. Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA) . Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM54 Antibody - N-terminal region : FITC (ARP43486_P050-FITC)
ARP43486_P050-FITC 100 µL

TRIM54 Antibody - N-terminal region : FITC (ARP43486_P050-FITC)

Sign In for Pricing
View Details
RANBP7 (Importin-7, Imp7, Ran-binding Protein 7, RanBP7, IPO7)
R1070-23C 100 µg

RANBP7 (Importin-7, Imp7, Ran-binding Protein 7, RanBP7, IPO7)

Sign In for Pricing
View Details
Olfr437 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4303808 1.0 µg DNA

Olfr437 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Daclatasvir (BMS-790052)
C16342-200mg 200 mg

Daclatasvir (BMS-790052)

Sign In for Pricing
View Details
St7 ORF Vector (Mouse) (pORF)
ORF058607 1.0 µg DNA

St7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
STN 703-052X105-B7541 (BRANDED) Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
251467 1 Card (1 Panel (s) x 1 Pack)

STN 703-052X105-B7541 (BRANDED) Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details