Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse

MIF Protein, Mouse has assumed an important role as a pivotal regulator of innate immunity.MIF Protein, Mouse promotes the pro-inflammatory functions of immune cells.

Product Specifications

Product Name Alternative

MIF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse.html

Purity

98.0

Smiles

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (M1-A115) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3 (10) :791-800.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT-pro BNP Rec. Ag
orb1785783 1 mg

Human NT-pro BNP Rec. Ag

Sign In for Pricing
View Details
Human TLR3 Pre-designed siRNA Set A
SI016711A 1 Each

Human TLR3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Nectin-1/CD111 (Rabbit, Monoclonal)
A107727 100 µL

Anti-Nectin-1/CD111 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
BAY 63-2521
2644-25 25 mg

BAY 63-2521

Sign In for Pricing
View Details
Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (Dylight488 Conjugate)
PB9627-Dylight488 100 µg

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Anti-PDE8A Antibody Picoband®, Dylight550 Conjugate
A05304-1-Dylight550 100 µg

Anti-PDE8A Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details