Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse

MIF Protein, Mouse has assumed an important role as a pivotal regulator of innate immunity.MIF Protein, Mouse promotes the pro-inflammatory functions of immune cells.

Product Specifications

Product Name Alternative

MIF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse.html

Purity

98.0

Smiles

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (M1-A115) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3 (10) :791-800.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse NKG2D (N-6His)
PHM2166-01 10 µg

Recombinant Mouse NKG2D (N-6His)

Sign In for Pricing
View Details
Recombinant Mouse NKG2D (N-6His)
PHM2166-02 50 µg

Recombinant Mouse NKG2D (N-6His)

Sign In for Pricing
View Details
Recombinant Mouse NKG2D (N-6His)
PHM2166-03 500 µg

Recombinant Mouse NKG2D (N-6His)

Sign In for Pricing
View Details
CD3E, CT (T-cell Surface Glycoprotein CD3 epsilon Chain, T-cell Surface Antigen T3/Leu-4 epsilon Chain, T3E) discontinued
C2254-18E 50 µg

CD3E, CT (T-cell Surface Glycoprotein CD3 epsilon Chain, T-cell Surface Antigen T3/Leu-4 epsilon Chain, T3E) discontinued

Sign In for Pricing
View Details
DGCR6L Rabbit Polyclonal Antibody
orb584837 100 µL

DGCR6L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CpCDPK1/TgCDPK1-IN-1
orb1944508-01 1 mg

CpCDPK1/TgCDPK1-IN-1

Sign In for Pricing
View Details