Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse

MIF Protein, Mouse has assumed an important role as a pivotal regulator of innate immunity.MIF Protein, Mouse promotes the pro-inflammatory functions of immune cells.

Product Specifications

Product Name Alternative

MIF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse.html

Purity

98.0

Smiles

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (M1-A115) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3 (10) :791-800.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST2H2AC Peptide
MBS3235293-01 0.1 mg

HIST2H2AC Peptide

Sign In for Pricing
View Details
HIST2H2AC Peptide
MBS3235293-02 5x 0.1 mg

HIST2H2AC Peptide

Sign In for Pricing
View Details
Gm16378 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3009608 1.0 µg DNA

Gm16378 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-Fruit fly Delta Sarcoglycan Antibody Fluoro647 Conjugated
DZ41104-Fluoro647 200 µL/Vial

Anti-Fruit fly Delta Sarcoglycan Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SHMT1 Antibody [Alexa Fluor 594]
NBP3-21429AF594 0.1 mL

Rabbit Polyclonal SHMT1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
CSTP1 Rabbit pAb, BF700 conjugated
orb2874670 100 µL

CSTP1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details