Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLTP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV688387 1.0 µg DNA

GLTP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NAT8B Recombinant Protein (Rat)
RP213326 100 µg

NAT8B Recombinant Protein (Rat)

Sign In for Pricing
View Details
LRRC7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1232106 1.0 µg DNA

LRRC7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MEK1 (Phospho-S298) Antibody
MBS9431068-01 0.05 mL

MEK1 (Phospho-S298) Antibody

Sign In for Pricing
View Details
MEK1 (Phospho-S298) Antibody
MBS9431068-02 0.1 mL

MEK1 (Phospho-S298) Antibody

Sign In for Pricing
View Details
MEK1 (Phospho-S298) Antibody
MBS9431068-03 5x 0.1 mL

MEK1 (Phospho-S298) Antibody

Sign In for Pricing
View Details