Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV629686 1.0 µg DNA

XRCC4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Rat acetylcholine receptor antibody (AChRab) ELISA Kit
GA-E0731RT-01 48 Tests

Rat acetylcholine receptor antibody (AChRab) ELISA Kit

Sign In for Pricing
View Details
Rat acetylcholine receptor antibody (AChRab) ELISA Kit
GA-E0731RT-02 96 Tests

Rat acetylcholine receptor antibody (AChRab) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human H2AC4 sgRNA gene knockout kit - Lentiviral human H2AC4 sgRNA gene knockout kit (25)
GTR15361767 1 Vial

Lentiviral human H2AC4 sgRNA gene knockout kit - Lentiviral human H2AC4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Chst3 (NM_016803) Mouse Tagged ORF Clone Lentiviral Particle
MR207541L3V 200 µL

Chst3 (NM_016803) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SCD1 Protein Vector (Mouse) (pPM-C-HA)
43135024 500 ng

SCD1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details