Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C-C motif chemokine 25 (CCL25) Elisa Kit
EK732206 96 Well

Mouse C-C motif chemokine 25 (CCL25) Elisa Kit

Sign In for Pricing
View Details
NIPSNAP2 Polyclonal Antibody
E55A04812 100 µg

NIPSNAP2 Polyclonal Antibody

Sign In for Pricing
View Details
Aco1 (NM_017321) Rat Untagged Clone
RN203228 10 µg

Aco1 (NM_017321) Rat Untagged Clone

Sign In for Pricing
View Details
TMEFF2 monoclonal antibody
A78062-100UL 100 µL

TMEFF2 monoclonal antibody

Sign In for Pricing
View Details
Filter Pump Made of Plastic
2063830/1 1 Each

Filter Pump Made of Plastic

Sign In for Pricing
View Details
HSPA1B (Heat Shock 70kD Protein 1B, FLJ54328, HSP70-1B, HSP70-2, HSPA1A) (HRP)
247290-HRP 100 µL

HSPA1B (Heat Shock 70kD Protein 1B, FLJ54328, HSP70-1B, HSP70-2, HSPA1A) (HRP)

Sign In for Pricing
View Details