Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Jagged 2 Antibody (746513) [PerCP]
FAB4748C 0.1 mL

Rat Monoclonal Jagged 2 Antibody (746513) [PerCP]

Sign In for Pricing
View Details
Recombinant Human vWF Protein (His tag)
E53A07665 50 µg

Recombinant Human vWF Protein (His tag)

Sign In for Pricing
View Details
UNC2881 500mg
A14276-500 500 mg

UNC2881 500mg

Sign In for Pricing
View Details
Phospholipid scramblase 2 (PLSCR2) (NM_020359) Human Over-expression Lysate
LH11127V 100 µg

Phospholipid scramblase 2 (PLSCR2) (NM_020359) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Cytochrome P450 2A7 (CYP2A7) ELISA Kit
MBS7251530-01 48 Well

Human Cytochrome P450 2A7 (CYP2A7) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome P450 2A7 (CYP2A7) ELISA Kit
MBS7251530-02 96 Well

Human Cytochrome P450 2A7 (CYP2A7) ELISA Kit

Sign In for Pricing
View Details