Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fetoprotein, Alpha (Alpha Fetoprotein, Alpha, Alpha-fetoprotein Precursor, AFP, Alpha-1-fetoprotein, Alpha-fetoglobulin, FETA, HPAFP) (HRP)
137954-HRP 100 µL

Fetoprotein, Alpha (Alpha Fetoprotein, Alpha, Alpha-fetoprotein Precursor, AFP, Alpha-1-fetoprotein, Alpha-fetoglobulin, FETA, HPAFP) (HRP)

Sign In for Pricing
View Details
CCDC29 sgRNA CRISPR Lentivector (Human) (Target 3)
K0375004 1.0 µg DNA

CCDC29 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Easypro Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cβ) ELISA Kit
FY-EH1571S 96 Well

Easypro Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cβ) ELISA Kit

Sign In for Pricing
View Details
SMG1 Recombinant Antibody, Cy3 Conjugated
bsm-62379R-Cy3 100 µL

SMG1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum rpsH Protein (aa 1-132) (strain Kyoto / Type A2)
VAng-Lsx8682-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum rpsH Protein (aa 1-132) (strain Kyoto / Type A2)

Sign In for Pricing
View Details
MDC (Macrophage Derived Chemokine, CCL22, ABCD1, DC/B-CK, SCYA22, STCP1, Chemokine C-C-Motif Ligand 22, Small Inducible Cytokine Subfamily A (Cys-Cys) Member 22, Stimulated T-Cell Chemotactic Protein 1)
364098 200 µL

MDC (Macrophage Derived Chemokine, CCL22, ABCD1, DC/B-CK, SCYA22, STCP1, Chemokine C-C-Motif Ligand 22, Small Inducible Cytokine Subfamily A (Cys-Cys) Member 22, Stimulated T-Cell Chemotactic Protein 1)

Sign In for Pricing
View Details