Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamitrinib TPP hexafluorophosphate 1mg
A21474-1 1 mg

Gamitrinib TPP hexafluorophosphate 1mg

Sign In for Pricing
View Details
Atp8b5 (NM_177195) Mouse Tagged ORF Clone
MR222788 10 µg

Atp8b5 (NM_177195) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bovine Free ProteIn S Fp-S ELISA Kit
BG-BVN11020 1 Each

Bovine Free ProteIn S Fp-S ELISA Kit

Sign In for Pricing
View Details
GP73 Double Nickase Plasmid (h)
sc-401581-NIC 20 µg

GP73 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse Smg8 shRNA (UAS) - Lentiviral mouse Smg8 shRNA (UAS, RFP) plasmid
GTR15264613 1 Vial

Lentiviral mouse Smg8 shRNA (UAS) - Lentiviral mouse Smg8 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mouse anti-human CD4 mAb (M16)
A09C02-m-M16 1 Each

Mouse anti-human CD4 mAb (M16)

Sign In for Pricing
View Details