Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-human-hek-293-his.html

Purity

98.0

Smiles

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42SE2 Protein Vector (Rat) (pPM-C-HA)
PV258880 500 ng

CDC42SE2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Phf5a Rat siRNA Oligo Duplex (Locus ID 192246)
SR500372 1 Kit

Phf5a Rat siRNA Oligo Duplex (Locus ID 192246)

Sign In for Pricing
View Details
CPEB4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0499403 1.0 µg DNA

CPEB4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HA Protein (C-AVI & His, H1N1)
P525159 100 µg

HA Protein (C-AVI & His, H1N1)

Sign In for Pricing
View Details
Goat Interleukin 6 (IL6) ELISA Kit
RDR-IL6-g-01 96 Tests

Goat Interleukin 6 (IL6) ELISA Kit

Sign In for Pricing
View Details
Goat Interleukin 6 (IL6) ELISA Kit
RDR-IL6-g-02 48 Tests

Goat Interleukin 6 (IL6) ELISA Kit

Sign In for Pricing
View Details