TARC/CCL17, Mouse (His)
The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
TARC/CCL17 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tarc-ccl17-protein-mouse-his.html
Purity
97.0
Smiles
ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Molecular Formula
20295 (Gene_ID) Q9WUZ6 (A24-P93) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MPP1 (55kD Erythrocyte Membrane Protein, p55, Membrane Protein, Palmitoylated 1, DXS552E, EMP55) (HRP)
TRIM33, CT (TRIM33, KIAA1113, RFG7, TIF1G, E3 ubiquitin-protein ligase TRIM33, Ectodermin homolog, RET-fused gene 7 protein, Transcription intermediary factor 1-gamma, Tripartite motif-containing protein 33) (MaxLight 650)
TRIM33, CT (TRIM33, KIAA1113, RFG7, TIF1G, E3 ubiquitin-protein ligase TRIM33, Ectodermin homolog, RET-fused gene 7 protein, Transcription intermediary factor 1-gamma, Tripartite motif-containing protein 33) (MaxLight 650)
