Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECH1, Human (His)

ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA) -linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ECH1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ech1-protein-human-his.html

Purity

98.0

Smiles

TGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL

Molecular Formula

1891 (Gene_ID) Q13011 (T34-L328) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-Apovincamine
TRC-A729245-25MG 25 mg

cis-Apovincamine

Sign In for Pricing
View Details
CO2 Incubator Water Jacketed BCWJ-8503
BCWJ-8503 1 Unit

CO2 Incubator Water Jacketed BCWJ-8503

Sign In for Pricing
View Details
Mouse Fbl activation kit by CRISPRa
GA201363 1 Kit

Mouse Fbl activation kit by CRISPRa

Sign In for Pricing
View Details
RASSF7 (NM_001143993) Human Over-expression Lysate
LC428453 20 µg

RASSF7 (NM_001143993) Human Over-expression Lysate

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLS1 (NM_002670) Human Over-expression Lysate
LC419176 20 µg

PLS1 (NM_002670) Human Over-expression Lysate

Sign In for Pricing
View Details