Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANP32A, Human (His)

The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag.

Product Specifications

Product Name Alternative

ANP32A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/anp32a-protein-human-his-gst.html

Purity

96.00

Smiles

EMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRK

Molecular Formula

8125 (Gene_ID) P39687 (E2-K238) (Accession)

Molecular Weight

Approximately 28 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alphaL discontinued
390555 200 µL

Integrin alphaL discontinued

Sign In for Pricing
View Details
2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose
UQC43429-01 5 mg

2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose

Sign In for Pricing
View Details
2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose
UQC43429-02 10 mg

2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose

Sign In for Pricing
View Details
2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose
UQC43429-03 25 mg

2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose

Sign In for Pricing
View Details
2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose
UQC43429-04 50 mg

2- (Acetylamino) -4-amino-2,4,6-trideoxy-α-D-galactopyranose

Sign In for Pricing
View Details
N-Benzylmethanesulfonamide
OR1064686-01 100 mg

N-Benzylmethanesulfonamide

Sign In for Pricing
View Details