Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 2/TGFB2, Mouse/Rat (HEK293)

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2) . TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development[1][2]. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293) is produced in HEK293 cells.

Product Specifications

Product Name Alternative

TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293), Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfb2-protein-mouse-rat-hek-293.html

Purity

98.0

Smiles

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS

Molecular Formula

21808 (Gene_ID) P27090 (A303-S414) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hirokazu Takahashi, et al. TGF-β2 is an exercise-induced adipokine that regulates glucose and fatty acid metabolism. Nat Metab. 2019 Feb;1 (2) :291-303.|[2]Zunqiang Xiao, et al. TGFβ2 is a prognostic-related biomarker and correlated with immune infiltrates in gastric cancer. J Cell Mol Med. 2020 Jul;24 (13) :7151-7162.|[3]Anne Dropmann, et al. TGF-β2 silencing to target biliary-derived liver diseases. Gut. 2020 Sep;69 (9) :1677-1690.|[4]Dona T Wu, et al. TGF-beta concentration specifies differential signaling profiles of growth arrest/differentiation and apoptosis in podocytes. J Am Soc Nephrol. 2005 Nov;16 (11) :3211-21.|[5]F J Kelly, et al. Acute and chronic renal effects of recombinant human TGF-beta2 in the rat. J Am Soc Nephrol. 1999 Jun;10 (6) :1264-73.|[6]B van't Land, et al. Transforming Growth Factor-beta2 protects the small intestine during methotrexate treatment in rats possibly by reducing stem cell cycling. Br J Cancer. 2002 Jul 1;87 (1) :113-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEF-3 Antibody
abx218224-01 50 µg

DEF-3 Antibody

Sign In for Pricing
View Details
DEF-3 Antibody
abx218224-02 100 µg

DEF-3 Antibody

Sign In for Pricing
View Details
OIF (OGN) (NM_014057) Human Tagged ORF Clone
RC210651 10 µg

OIF (OGN) (NM_014057) Human Tagged ORF Clone

Sign In for Pricing
View Details
Olfr970 Lentiviral Activation Particles (m2)
sc-434733-LAC-2 200 µL

Olfr970 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Monoclonal MIS/AMH Antibody (016)
NBP2-90332-100ul 100 µL

Rabbit Monoclonal MIS/AMH Antibody (016)

Sign In for Pricing
View Details
Anti-FGF-14 Antibody (3C253)
TMAY-02616 100 µL

Anti-FGF-14 Antibody (3C253)

Sign In for Pricing
View Details