Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

Product Specifications

Product Name Alternative

Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

Abbreviation

Recombinant Human coronavirus HKU1 Non-structural protein 4

Gene Name

4

UniProt

Q0ZME6

Expression Region

1-109aa

Organism

Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)

Target Sequence

MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein & Coronavirus Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYROXD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV664551 1.0 µg DNA

PYROXD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Hmgcs1 (NM_145942) Mouse Tagged ORF Clone Lentiviral Particle
MR208329L4V 200 µL

Hmgcs1 (NM_145942) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MRGPRX4 Protein Vector (Human) (pPM-C-His)
PV055228 500 ng

MRGPRX4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Digoxigenin Bisdigitoxoside
TRC-D446500-25MG 25 mg

Digoxigenin Bisdigitoxoside

Sign In for Pricing
View Details
SLC16A3 (NM_001042423) Human Tagged ORF Clone
RC218243 10 µg

SLC16A3 (NM_001042423) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRNAR29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48351111 3x 1.0 µg

TRNAR29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details