Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTHRC1, Rat (HEK293, His)

CTHRC1, with predicted Wnt-protein and frizzled binding activity, influences cell migration. Located in the extracellular matrix, this protein, implicated in Barrett's esophagus, exhibits biased expression in lung (RPKM 46.1) and muscle (RPKM 36.6), suggesting its role in diverse physiological processes across tissues. CTHRC1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTHRC1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTHRC1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cthrc1-protein-rat-hek293-his.html

Purity

93.0

Smiles

SENPKYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Molecular Formula

282836 (Gene_ID) NP_001258229 (S33-K230) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSGIN2 Antibody, Biotin conjugated
A72446-100UG 100 µg

OSGIN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit
MBS7212935-01 48 Well

Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit
MBS7212935-02 96 Well

Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit
MBS7212935-03 5x 96 Well

Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit
MBS7212935-04 10x 96 Well

Mouse Alpha- (1, 3) -fucosyltransferase (FUT4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ING5 Antibody [Alexa Fluor 750]
NBP3-06217AF750 0.1 mL

Rabbit Polyclonal ING5 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details