CXADR, Human (HEK293, His)
CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CXADR Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cxadr-protein-human-hek-293-his.html
Purity
98.0
Smiles
LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG
Molecular Formula
1525 (Gene_ID) P78310/NP_001329.1 (L20-G237) (Accession)
Molecular Weight
Approximately 32.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470260-100 1x 100 µL
IgM Immunoglobulin (IM260), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941471-100 1x 100 µL
Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details