Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTSS1, Human (His)

MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 Protein, Human (His) is the recombinant human-derived MTSS1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MTSS1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mtss1-protein-human-his-mbp.html

Purity

98.0

Smiles

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGS

Molecular Formula

9788 (Gene_ID) EAW92073 (M1-S250) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Kallikrein 9 ELISA Kit
MBS068417-01 48 Well

Canine Kallikrein 9 ELISA Kit

Sign In for Pricing
View Details
Canine Kallikrein 9 ELISA Kit
MBS068417-02 96 Well

Canine Kallikrein 9 ELISA Kit

Sign In for Pricing
View Details
Canine Kallikrein 9 ELISA Kit
MBS068417-03 5x 96 Well

Canine Kallikrein 9 ELISA Kit

Sign In for Pricing
View Details
Canine Kallikrein 9 ELISA Kit
MBS068417-04 10x 96 Well

Canine Kallikrein 9 ELISA Kit

Sign In for Pricing
View Details
ABCB7 Rabbit Polyclonal Antibody (FITC)
orb2083626 100 µL

ABCB7 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ZFP36L1 (Zinc Finger Protein 36, C3H1 Type-like 1, Butyrate Response Factor 1, EGF-response Factor 1, ERF-1, Protein TIS11B, BERG36, BRF1, ERF1, RNF162B, TIS11B) (MaxLight 490)
MBS6204154-01 0.1 mL

ZFP36L1 (Zinc Finger Protein 36, C3H1 Type-like 1, Butyrate Response Factor 1, EGF-response Factor 1, ERF-1, Protein TIS11B, BERG36, BRF1, ERF1, RNF162B, TIS11B) (MaxLight 490)

Sign In for Pricing
View Details