Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-1 alpha (IL1A) (Active)

Product Specifications

Product Name Alternative

IL-1 alpha

Abbreviation

Recombinant Rhesus macaque IL1A protein (Active)

Gene Name

IL1A

UniProt

P48089

Expression Region

113-271aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 x 108 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD36 Protein (C-His, Human)
P502049 100 µg

CD36 Protein (C-His, Human)

Sign In for Pricing
View Details
Lentiviral human MAP11 sgRNA gene knockout kit - Lentiviral human MAP11 sgRNA gene knockout kit (25)
GTR15367761 1 Vial

Lentiviral human MAP11 sgRNA gene knockout kit - Lentiviral human MAP11 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ADAM9 3'UTR Luciferase Stable Cell Line
TU000296 1.0 mL

ADAM9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Oxyresveratrol 4,3,5- tri-glucoside
M38929-01 100 mg

Oxyresveratrol 4,3,5- tri-glucoside

Sign In for Pricing
View Details
Oxyresveratrol 4,3,5- tri-glucoside
M38929-02 25 mg

Oxyresveratrol 4,3,5- tri-glucoside

Sign In for Pricing
View Details
Oxyresveratrol 4,3,5- tri-glucoside
M38929-03 50 mg

Oxyresveratrol 4,3,5- tri-glucoside

Sign In for Pricing
View Details