CTHRC1, Human (HEK293, His)
CTHRC1 Protein, Human (HEK293, His) is a negative regulator of collagen matrix deposition. CTHRC1, a secreted 28-kDa protein, is a glycosylated protein with a signal sequence.
Product Specifications
Product Name Alternative
CTHRC1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cthrc1-protein-human-hek293-his.html
Purity
95.52
Smiles
SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Molecular Formula
115908 (Gene_ID) Q96CG8-1 (S31-K243) (Accession)
Molecular Weight
Approximately 24-32 kDa due to the glycosylation.
References & Citations
[1]Xusheng Ding, et al. CTHRC1 promotes gastric cancer metastasis via HIF-1α/CXCR4 signaling pathway. Biomed Pharmacother. 2020 Mar;123:109742.|[2]Peter Pyagay, et al. Collagen triple helix repeat containing 1, a novel secreted protein in injured and diseased arteries, inhibits collagen expression and promotes cell migration. Circ Res. 2005 Feb 4;96 (2) :261-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details