Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTHRC1, Human (HEK293, His)

CTHRC1 Protein, Human (HEK293, His) is a negative regulator of collagen matrix deposition. CTHRC1, a secreted 28-kDa protein, is a glycosylated protein with a signal sequence.

Product Specifications

Product Name Alternative

CTHRC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cthrc1-protein-human-hek293-his.html

Purity

95.52

Smiles

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Molecular Formula

115908 (Gene_ID) Q96CG8-1 (S31-K243) (Accession)

Molecular Weight

Approximately 24-32 kDa due to the glycosylation.

References & Citations

[1]Xusheng Ding, et al. CTHRC1 promotes gastric cancer metastasis via HIF-1α/CXCR4 signaling pathway. Biomed Pharmacother. 2020 Mar;123:109742.|[2]Peter Pyagay, et al. Collagen triple helix repeat containing 1, a novel secreted protein in injured and diseased arteries, inhibits collagen expression and promotes cell migration. Circ Res. 2005 Feb 4;96 (2) :261-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Islet Antigen-2 Antibody/protein-Tyrosine Phosphatase IA-2A/PTP ELISA Kit
BG-BVN11397 1 Each

Bovine Islet Antigen-2 Antibody/protein-Tyrosine Phosphatase IA-2A/PTP ELISA Kit

Sign In for Pricing
View Details
HIV-1 integrase Inhibitor 8
MBS5803466 Inquire

HIV-1 integrase Inhibitor 8

Sign In for Pricing
View Details
Recombinant Major capsid protein L1 (L1), partial
MBS1152797-01 0.05 mg (Baculovirus)

Recombinant Major capsid protein L1 (L1), partial

Sign In for Pricing
View Details
Recombinant Major capsid protein L1 (L1), partial
MBS1152797-02 0.2 mg (Baculovirus)

Recombinant Major capsid protein L1 (L1), partial

Sign In for Pricing
View Details
Recombinant Major capsid protein L1 (L1), partial
MBS1152797-03 0.5 mg (Baculovirus)

Recombinant Major capsid protein L1 (L1), partial

Sign In for Pricing
View Details
Recombinant Major capsid protein L1 (L1), partial
MBS1152797-04 1 mg (Baculovirus)

Recombinant Major capsid protein L1 (L1), partial

Sign In for Pricing
View Details