Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZG16B, Human (P.pastoris, His)

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (P.pastoris, His) is the recombinant human-derived ZG16B protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZG16B Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zg16b-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Molecular Formula

124220 (Gene_ID) Q96DA0 (G53-R208) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POM121L12 (NM_182595) Human Tagged ORF Clone Lentiviral Particle
RC218067L4V 200 µL

POM121L12 (NM_182595) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rinl Rat shRNA Plasmid (Locus ID 292760)
TL704828 1 Kit

Rinl Rat shRNA Plasmid (Locus ID 292760)

Sign In for Pricing
View Details
Gm14692 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3132403 1.0 µg DNA

Gm14692 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-GRIN2C antibody
STJ116454 100 µl

Anti-GRIN2C antibody

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0756 membrane protein YeaL (yeaL), partial
MBS7067556 Inquire

Recombinant Salmonella enteritidis PT4 UPF0756 membrane protein YeaL (yeaL), partial

Sign In for Pricing
View Details
Spg21 Rat siRNA Oligo Duplex (Locus ID 300791)
SR501587 1 Kit

Spg21 Rat siRNA Oligo Duplex (Locus ID 300791)

Sign In for Pricing
View Details