BMP-3, Human
BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
BMP-3 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bmp-3-protein-human.html
Purity
98.00
Smiles
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Molecular Formula
651 (Gene_ID) P12645 (Q363-R472) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
LYVE-1 (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, CRSBP-1, HAR, XLKD1)
Lentiviral mouse Il5 shRNA (UAS) - Lentiviral mouse Il5 shRNA (UAS, RFP) (100)
