Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3, Human

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

BMP-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3-protein-human.html

Purity

98.00

Smiles

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Molecular Formula

651 (Gene_ID) P12645 (Q363-R472) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140287-01 24 Strip Well

Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit

Ask
View Details
Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140287-02 48 Well

Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit

Ask
View Details
Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140287-03 96 Well

Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit

Ask
View Details
Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140287-04 5x 96 Well

Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit

Ask
View Details
Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140287-05 10x 96 Well

Guinea pig Tumor Necrosis Factor Alpha (TNFa)(Sandwich ELISA) Mini sample ELISA Kit

Ask
View Details
3,5,7-Trihydroxychromone 3-O-?-D-xylopyranoside
MF-0020346 5 mg

3,5,7-Trihydroxychromone 3-O-?-D-xylopyranoside

Ask
View Details