Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3, Human

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

BMP-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3-protein-human.html

Purity

98.00

Smiles

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Molecular Formula

651 (Gene_ID) P12645 (Q363-R472) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WAY-648936
MBS5822442 Inquire

WAY-648936

Sign In for Pricing
View Details
CD59 Rabbit Polyclonal Antibody (BF594)
orb2535435 100 µL

CD59 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Pseudocoptisine acetate
T12570 5 mg

Pseudocoptisine acetate

Sign In for Pricing
View Details
Rat Adenosine Kinase (ADK) ELISA Kit
SL2146Ra-01 48 Tests

Rat Adenosine Kinase (ADK) ELISA Kit

Sign In for Pricing
View Details
Rat Adenosine Kinase (ADK) ELISA Kit
SL2146Ra-02 96 Tests

Rat Adenosine Kinase (ADK) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Atlastin-3 Antibody [Janelia Fluor 549]
NBP2-97067JF549 0.1 mL

Rabbit Polyclonal Atlastin-3 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details