Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chymase/CMA1, Mouse (His)

Chymase/CMA1 Protein, a prominent secreted protease in mast cells, is implicated in various physiological processes, including the generation of vasoactive peptides, extracellular matrix degradation, and the regulation of gland secretion.Chymase/CMA1 Protein, Mouse (His) is the recombinant mouse-derived Chymase/CMA1 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Chymase/CMA1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chymase-cma1-mouse-his.html

Purity

90.00

Smiles

IGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN

Molecular Formula

17228 (Gene_ID) P21844 (I22-E246) (Accession)

Molecular Weight

Approximately 29.2kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTN4R antibody
70R-51087 100 µL

RTN4R antibody

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Apocytochrome f (petA)
orb2927333-01 20 µg

Recombinant Synechococcus sp. Apocytochrome f (petA)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Apocytochrome f (petA)
orb2927333-02 100 µg

Recombinant Synechococcus sp. Apocytochrome f (petA)

Sign In for Pricing
View Details
OCT-4 Antibody
79-645 0.1 mg

OCT-4 Antibody

Sign In for Pricing
View Details
SLC2A2 Antibody
orb1743706-01 50 µL

SLC2A2 Antibody

Sign In for Pricing
View Details
SLC2A2 Antibody
orb1743706-02 100 µL

SLC2A2 Antibody

Sign In for Pricing
View Details