Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHB, Human (His)

The LDHB protein, also known as lactate dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. References indicate that the LDHB protein effectively catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. LDHB Protein, Human (His) is the recombinant human-derived LDHB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LDHB Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ldhb-protein-human-his.html

Purity

98.0

Smiles

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Molecular Formula

3945 (Gene_ID) P07195 (M1-L334) (Accession)

Molecular Weight

Approximately 37.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT4 Polyclonal Antibody
MBS9126669-01 0.02 mL

GALNT4 Polyclonal Antibody

Sign In for Pricing
View Details
GALNT4 Polyclonal Antibody
MBS9126669-02 0.05 mL

GALNT4 Polyclonal Antibody

Sign In for Pricing
View Details
GALNT4 Polyclonal Antibody
MBS9126669-03 0.1 mL

GALNT4 Polyclonal Antibody

Sign In for Pricing
View Details
GALNT4 Polyclonal Antibody
MBS9126669-04 0.2 mL

GALNT4 Polyclonal Antibody

Sign In for Pricing
View Details
GALNT4 Polyclonal Antibody
MBS9126669-05 5x 0.2 mL

GALNT4 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse TH Protein, N-His
YMC22901 100 μg

Recombinant Mouse TH Protein, N-His

Sign In for Pricing
View Details