CD7, Rat (HEK293, Fc)
The CD7 Protein is a member of the immunoglobulin superfamily expressed in thymocytes and mature T cells. CD7 Protein can activate the PI3K signaling pathway involved in the activation of T and NK cells. CD7 Protein is a key factor in the treatment of T-cell acute lymphoblastic leukemia (T-ALL) and T-lymphoma. CD7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD7 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD7 Protein, Rat (HEK293, Fc), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd7-protein-rat-hek293-fc.html
Purity
97.0
Smiles
QEVHQSPRVVIASEGESINITCSTRGDLEGLIMKRIWPQASNVIYFEDELEPTVDSAFSGRINFSGSQKNLTIIMSLLQEADTGAYTCEAVRKVSVHGLFTTVVVKEKLSHEAYRSQEPLQTSVSLP
Molecular Formula
303747 (Gene_ID) B2RZ54 (Q23-P149) (Accession)
Molecular Weight
Approximately 45-60 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Ashbya gossypii Palmitoyltransferase SWF1 (SWF1), partial
Fetuin A/α-2-Heremans Schmid Glycoprotein (FETUA/aHSG) Rabbit ELISA Kit
Recombinant Human PFKFB4 Protein - (Dry Ice)
Anti-DDAH1 Antibody Picoband® (APC Conjugate)