Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM2A, Human (HEK293, His)

Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. GM2A catalyzes the degradation of the ganglioside GM2 as well as affects lipid storage and neuromuscular process controlling balance. GM2A Protein, Human (HEK293, His) is the recombinant human-derived GM2A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm2a-protein-human-hek-293-his.html

Purity

98.0

Smiles

SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Molecular Formula

2760 (Gene_ID) AAH09273.1 (S32-I193) (Accession)

Molecular Weight

19-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), Biotin conjugate, 0.1mg/mL
BNCB2149-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Scaffold attachment factor B2 (SAFB2) Human Gene Knockout Kit (CRISPR)
KN421384 1 Kit

Scaffold attachment factor B2 (SAFB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(AlphaS,BetaS)-rel-Bedaquiline-d6
TRC-B119558-1MG 1 mg

(AlphaS,BetaS)-rel-Bedaquiline-d6

Sign In for Pricing
View Details
RBM3 Human Gene Knockout Kit (CRISPR)
KN201659RB 1 Kit

RBM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1H-Pyrazole-1-carboxamidine Hydrochloride
TRC-P842500-2.5G 2.5 g

1H-Pyrazole-1-carboxamidine Hydrochloride

Sign In for Pricing
View Details
Alpha 2 Antiplasmin (SERPINF2) (NM_001165921) Human Over-expression Lysate
LC431370 20 µg

Alpha 2 Antiplasmin (SERPINF2) (NM_001165921) Human Over-expression Lysate

Sign In for Pricing
View Details