Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM2A, Human (HEK293, His)

Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. GM2A catalyzes the degradation of the ganglioside GM2 as well as affects lipid storage and neuromuscular process controlling balance. GM2A Protein, Human (HEK293, His) is the recombinant human-derived GM2A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm2a-protein-human-hek-293-his.html

Purity

98.0

Smiles

SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Molecular Formula

2760 (Gene_ID) AAH09273.1 (S32-I193) (Accession)

Molecular Weight

19-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[pGlu3]-Amyloid-beta Protein (3-42) (Human)
018-64 100 µg

[pGlu3]-Amyloid-beta Protein (3-42) (Human)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 12A (TNFRSF12A) Antibody
abx457192-01 50 µg

Tumor Necrosis Factor Receptor Superfamily Member 12A (TNFRSF12A) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 12A (TNFRSF12A) Antibody
abx457192-02 100 µg

Tumor Necrosis Factor Receptor Superfamily Member 12A (TNFRSF12A) Antibody

Sign In for Pricing
View Details
WNK3, Active
MBS517788-01 0.01 mg

WNK3, Active

Sign In for Pricing
View Details
WNK3, Active
MBS517788-02 0.05 mg

WNK3, Active

Sign In for Pricing
View Details
WNK3, Active
MBS517788-03 0.5 mg

WNK3, Active

Sign In for Pricing
View Details