Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P2Y purinoceptor 12 (P2RY12)

Product Specifications

Product Name Alternative

ADP-glucose receptor (ADPG-R) (P2T) (P2Y (AC) ) (P2Y (cyc) ) (P2Y12 platelet ADP receptor) (P2Y (ADP) ) (SP1999) (HORK3) (P2Y12)

Abbreviation

Recombinant Human P2RY12 protein

Gene Name

P2RY12

UniProt

Q9H244

Expression Region

1-342aa

Organism

Homo sapiens (Human)

Target Sequence

MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.

Molecular Weight

42.2 kDa

References & Citations

"Molecular bases of defective signal transduction in the platelet P2Y12 receptor of a patient with congenital bleeding." Cattaneo M., Zighetti M.L., Lombardi R., Martinez C., Lecchi A., Conley P.B., Ware J., Ruggeri Z.M. Proc. Natl. Acad. Sci. U.S.A. 100:1978-1983 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPK2 Rabbit Polyclonal Antibody
TA371848 100 µL

ALPK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vaccenic Acid Ethyl-d5 Ester
TRC-V070007-5MG 5 mg

Vaccenic Acid Ethyl-d5 Ester

Sign In for Pricing
View Details
Crude Trichosanthes kirilowii (China Gourd) -TKA-200mg
L-5600-200 200 mg

Crude Trichosanthes kirilowii (China Gourd) -TKA-200mg

Sign In for Pricing
View Details
Belimumab Biosimilar - Research Grade
ICH5080-1mg 1 mg

Belimumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF640R conjugate, 0.1mg/mL
BNC401284-100 1x 100 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GUCY2F (NM_001522) Human Over-expression Lysate
LY419882 100 µg

GUCY2F (NM_001522) Human Over-expression Lysate

Sign In for Pricing
View Details