Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein C-I (Apoc1)

Product Specifications

Product Name Alternative

Apolipoprotein C1

Abbreviation

Recombinant Mouse Apoc1 protein

Gene Name

Apoc1

UniProt

P34928

Expression Region

27-88aa

Organism

Mus musculus (Mouse)

Target Sequence

APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Cardiovascular

Relevance

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP) . Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP) . Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (By similarity) . Binds free fatty acids and reduces their intracellular esterification.

Molecular Weight

12.5 kDa

References & Citations

"Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications." Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P. Biochim. Biophys. Acta 1764:1363-1371 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse glucocorticoid receptor, GR ELISA Kit
NB-E20254 96 Well

Mouse glucocorticoid receptor, GR ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 Spike Protein Antibody
orb1319614 100 µL

SARS-CoV-2 Spike Protein Antibody

Sign In for Pricing
View Details
Senp17 Protein Vector (Rat) (pPB-N-His)
PV304075 500 ng

Senp17 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
SRSF10 Antibody - C-terminal region : HRP (ARP41083_P050-HRP)
ARP41083_P050-HRP 100 µL

SRSF10 Antibody - C-terminal region : HRP (ARP41083_P050-HRP)

Sign In for Pricing
View Details
KI18B rabbit pAb
ES19784-01 50 µL

KI18B rabbit pAb

Sign In for Pricing
View Details
KI18B rabbit pAb
ES19784-02 100 µL

KI18B rabbit pAb

Sign In for Pricing
View Details