Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-3 (VI) chain (COL6A3), partial

Product Specifications

Product Name Alternative

CO6A3_HUMAN; COL6A3; Collagen alpha-3 (VI) chain; Collagen type VI alpha 3; Collagen VI alpha 3

Abbreviation

Recombinant Human COL6A3 protein, partial

Gene Name

COL6A3

UniProt

P12111

Expression Region

2853-3176aa

Organism

Homo sapiens (Human)

Target Sequence

HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

In vitro E.coli expression system

Field of Research

Cancer

Relevance

Collagen VI acts as a cell-binding protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.5 kDa

References & Citations

"Mosaic structure of globular domains in the human type VI collagen alpha 3 chain: similarity to von Willebrand factor, fibronectin, actin, salivary proteins and aprotinin type protease inhibitors." Chu M.-L., Zhang R.-Z., Pan T.-C., Stokes D., Conway D., Kuo H.-J., Glanville R., Mayer U., Mann K., Deutzmann R., Timpl R. EMBO J. 9:385-393 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLTCL1 Antibody (Biotin)
KB-17742-01 50 μL

CLTCL1 Antibody (Biotin)

Sign In for Pricing
View Details
CLTCL1 Antibody (Biotin)
KB-17742-02 100 µL

CLTCL1 Antibody (Biotin)

Sign In for Pricing
View Details
CLTCL1 Antibody (Biotin)
KB-17742-03 1 mL

CLTCL1 Antibody (Biotin)

Sign In for Pricing
View Details
N,N’-Diacetyl DAMPA Ethyl Ester
TRC-D314000-1MG 1 mg

N,N’-Diacetyl DAMPA Ethyl Ester

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF488A conjugate, 0.1mg/mL
BNC882034-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (rMTAP/1813), CF647 conjugate, 0.1mg/mL
BNC473646-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (rMTAP/1813), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details