Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV)
Product Specifications
Product Name Alternative
RplV; APH_0285; 50S ribosomal protein L22
Abbreviation
Recombinant Anaplasma phagocytophilum rplV protein
Gene Name
RplV
UniProt
Q2GL54
Expression Region
1-112aa
Organism
Anaplasma phagocytophilum (strain HZ)
Target Sequence
MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Type
Developed Protein
Source
In vitro E.coli expression system
Field of Research
Epigenetics and Nuclear Signaling
Relevance
This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity) .
Molecular Weight
32.2 kDa
References & Citations
"Comparative genomics of emerging human ehrlichiosis agents."Dunning Hotopp J.C., Lin M., Madupu R., Crabtree J.Tettelin H. PLoS Genet. 2:208-222 (2006)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog