Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cerebellin-3 (Cbln3)

Product Specifications

Product Name Alternative

Cbln3Cerebellin-3

Abbreviation

Recombinant Mouse Cbln3 protein

Gene Name

Cbln3

UniProt

Q9JHG0

Expression Region

25-197aa

Organism

Mus musculus (Mouse)

Target Sequence

QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

May be involved in synaptic functions in the CNS.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in synaptic functions in the CNS.

Molecular Weight

34.4 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF568 conjugate, 0.1mg/mL
BNC681958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562390 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Mouse IgG,
AA-2361-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Mouse IgG,

Sign In for Pricing
View Details
Activin A Receptor Type IC (ACVR1C) (N-term) Rabbit Polyclonal Antibody
AP13709PU-N 400 µL

Activin A Receptor Type IC (ACVR1C) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccl1 Mouse Gene Knockout Kit (CRISPR)
KN502777 1 Kit

Ccl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF405S conjugate, 0.1mg/mL
BNC040942-500 1x 500 µL

Milk Fat Globulin (EDM45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details