Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Anionic trypsin

Product Specifications

Product Name Alternative

; Anionic trypsin; EC 3.4.21.4

Abbreviation

Recombinant Dog Anionic trypsin protein

UniProt

P06872

Expression Region

24-247aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40 kDa

References & Citations

"Differential regulation of trypsinogen mRNA translation: full-length mRNA sequences encoding two oppositely charged trypsinogen isoenzymes in the dog pancreas."Pinsky S.D., Laforge K.S., Scheele G.Mol. Cell. Biol. 5:2669-2676 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CORO6 Pre-designed siRNA Set B
SI003484B 1 Each

Human CORO6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SPR Peptide - C-terminal region
MBS3239364-01 0.1 mg

SPR Peptide - C-terminal region

Sign In for Pricing
View Details
SPR Peptide - C-terminal region
MBS3239364-02 5x 0.1 mg

SPR Peptide - C-terminal region

Sign In for Pricing
View Details
Porcine Spondin 1 (SPON1) ELISA kit
GTR10439567 96 Well

Porcine Spondin 1 (SPON1) ELISA kit

Sign In for Pricing
View Details
Atp7a (NM_009726) Mouse Tagged ORF Clone Lentiviral Particle
MR225903L3V 200 µL

Atp7a (NM_009726) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SIDT1, ID (SIDT1, SID1 transmembrane family member 1) (AP)
MBS6347549-01 0.2 mL

SIDT1, ID (SIDT1, SID1 transmembrane family member 1) (AP)

Sign In for Pricing
View Details