Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB)

Product Specifications

Product Name Alternative

Antigen CD42b-beta CD_antigen: CD42c

Abbreviation

Recombinant Human GP1BB protein

Gene Name

GP1BB

UniProt

P13224

Expression Region

26-206aa

Organism

Homo sapiens (Human)

Target Sequence

CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Molecular Weight

39.3 kDa

References & Citations

"The alpha and beta chains of human platelet glycoprotein Ib are both transmembrane proteins containing a leucine-rich amino acid sequence." Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Davie E.W., Roth G.J. Proc. Natl. Acad. Sci. U.S.A. 85:2135-2139 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prolactin (PRL) ELISA Kit
RDR-PRL-Mu-01 96 Tests

Mouse Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
Mouse Prolactin (PRL) ELISA Kit
RDR-PRL-Mu-02 48 Tests

Mouse Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
RAE1 (NM_001015885) Human Over-expression Lysate
LC423133 20 µg

RAE1 (NM_001015885) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC34A2 Human Gene Knockout Kit (CRISPR)
KN218736BN 1 Kit

SLC34A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRID2IP (NM_001145118) Human Over-expression Lysate
LY428702 100 µg

GRID2IP (NM_001145118) Human Over-expression Lysate

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), Biotin conjugate, 0.1mg/mL
BNCB2125-500 1x 500 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details