Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1)

Product Specifications

Product Name Alternative

Progestin and adipoQ receptor family member I

Abbreviation

Recombinant Human ADIPOR1 protein

Gene Name

ADIPOR1

UniProt

Q96A54

Expression Region

1-375aa

Organism

Homo sapiens (Human)

Target Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Cardiovascular

Relevance

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism

Molecular Weight

62.6 kDa

References & Citations

"PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif." Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D. J. Mol. Evol. 61:372-380 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBCO Sulfo-NHS Ester
4527-AAT 5 mg

DBCO Sulfo-NHS Ester

Sign In for Pricing
View Details
(+/-)-Exo-6-hydroxytropinone
TRC-E975135-50MG 50 mg

(+/-)-Exo-6-hydroxytropinone

Sign In for Pricing
View Details
Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody
RC-16745-01 50 μL

Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody

Sign In for Pricing
View Details
Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody
RC-16745-02 100 µL

Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody

Sign In for Pricing
View Details
Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody
RC-16745-03 1 mL

Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody

Sign In for Pricing
View Details
Mouse Antithrombin (AT) ELISA Kit
RD-AT-Mu-01 96 Tests

Mouse Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details