Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1A1 (OR1A1)

Product Specifications

Product Name Alternative

Olfactory receptor 17-7

Abbreviation

Recombinant Human OR1A1 protein

Gene Name

OR1A1

UniProt

Q9P1Q5

Expression Region

1-309aa

Organism

Homo sapiens (Human)

Target Sequence

MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS

Tag

N-terminal 6xHis-SUMO-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

Odorant receptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Odorant receptor.

Molecular Weight

50.6 kDa

References & Citations

"Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2." Schmiedeberg K., Shirokova E., Weber H.P., Schilling B., Meyerhof W., Krautwurst D. J. Struct. Biol. 159:400-412 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYCBPAP CRISPRa sgRNA lentivector (set of three targets)(Human)
31211121 3x 1.0µg DNA

MYCBPAP CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
POD-1 siRNA (m)
sc-38186 10 µM

POD-1 siRNA (m)

Sign In for Pricing
View Details
Research Grade Anti-Human PSCA (AGS-1C4D4)
MBS1580342-01 0.1 mg

Research Grade Anti-Human PSCA (AGS-1C4D4)

Sign In for Pricing
View Details
Research Grade Anti-Human PSCA (AGS-1C4D4)
MBS1580342-02 1 mg

Research Grade Anti-Human PSCA (AGS-1C4D4)

Sign In for Pricing
View Details
Research Grade Anti-Human PSCA (AGS-1C4D4)
MBS1580342-03 5x 1 mg

Research Grade Anti-Human PSCA (AGS-1C4D4)

Sign In for Pricing
View Details
Acyl coenzyme A Thioesterase 8 (ACOT8) (NM_005469) Human Tagged ORF Clone Lentiviral Particle
RC214175L4V 200 µL

Acyl coenzyme A Thioesterase 8 (ACOT8) (NM_005469) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details