Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6), partial

Product Specifications

Product Name Alternative

Skullin

Abbreviation

Recombinant Human CLDN6 protein, partial

Gene Name

CLDN6

UniProt

P56747

Expression Region

1-82aa

Organism

Homo sapiens (Human)

Target Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA

Tag

N-terminal 6xHis-SUMO-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Microbiology

Relevance

Plays a major role in tight junction-specific obliteration of the intercellular space (By similarity) . May act as a coreceptor for HCV entry into hepatic cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a major role in tight junction-specific obliteration of the intercellular space.

Molecular Weight

24.8 kDa

References & Citations

"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRC (pp60Src, pp60c-Src) (MaxLight 650)
MBS6246304-01 0.1 mL

SRC (pp60Src, pp60c-Src) (MaxLight 650)

Sign In for Pricing
View Details
SRC (pp60Src, pp60c-Src) (MaxLight 650)
MBS6246304-02 5x 0.1 mL

SRC (pp60Src, pp60c-Src) (MaxLight 650)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136601-01 0.1 mL

FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136601-02 0.2 mL

FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136601-03 0.5 mL

FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136601-04 1 mL

FITC Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details