Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-1 receptor (EDNRA)

Product Specifications

Product Name Alternative

Endothelin A receptor

Abbreviation

Recombinant Human EDNRA protein

Gene Name

EDNRA

UniProt

P25101

Expression Region

21-427aa

Organism

Homo sapiens (Human)

Target Sequence

DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

Tag

C-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Signal Transduction

Relevance

Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is

Molecular Weight

48.5 kDa

References & Citations

"Molecular cloning of human endothelin receptors and their expression in vascular endothelial cells and smooth muscle cells."Arai H., Nakao K., Hosoda K., Ogawa Y., Nakagawa O., Komatsu Y., Imura H.Jpn. Circ. J. 56:1303-1307 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABLIM2 (NM_001130088) Human Over-expression Lysate
LC427156 20 µg

ABLIM2 (NM_001130088) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PF4 (Platelet Factor 4) ELISA Kit
E-EL-H6184-01 24 Tests

Human PF4 (Platelet Factor 4) ELISA Kit

Sign In for Pricing
View Details
Human PF4 (Platelet Factor 4) ELISA Kit
E-EL-H6184-02 48 Tests

Human PF4 (Platelet Factor 4) ELISA Kit

Sign In for Pricing
View Details
Human PF4 (Platelet Factor 4) ELISA Kit
E-EL-H6184-03 96 Tests

Human PF4 (Platelet Factor 4) ELISA Kit

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) (NM_000298) Human Over-expression Lysate
LC400113 20 µg

Pyruvate Kinase (PKLR) (NM_000298) Human Over-expression Lysate

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A9]
TA806679AM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A9]

Sign In for Pricing
View Details