Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Product Specifications

Product Name Alternative

ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K (+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10

Abbreviation

Recombinant Human KCNJ10 protein

Gene Name

KCNJ10

UniProt

P78508

Expression Region

1-379aa

Organism

Homo sapiens (Human)

Target Sequence

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Tag

N-terminal 6xHis-SUMO-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity) . In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity) . In the kidney, together with KCNJ16, mediates basolateral K (+) recycling in distal tubules; this process is critical for Na (+) reabsorption at the tubules.

Molecular Weight

58.5 kDa

References & Citations

"Co-expression of human Kir3 subunits can yield channels with different functional properties."Schoots O., Wilson J.M., Ethier N., Bigras E., Hebert T.E., Van Tol H.H.M.Cell. Signal. 11:871-883 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF660R conjugate, 0.1mg/mL
BNC610470-100 1x 100 µL

CD45 / LCA (2B11), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF405S conjugate, 0.1mg/mL
BNC040714-100 1x 100 µL

Thymidylate Synthase (TS106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF405S conjugate, 0.1mg/mL
BNC041467-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details