Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I5 (VACWR074)

Product Specifications

Product Name Alternative

Protein VP13K

Abbreviation

Recombinant Vaccinia virus VACWR074 protein

Gene Name

VACWR074

UniProt

P12924

Expression Region

2-79aa

Organism

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Target Sequence

VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS

Tag

N-terminal 6xHis-SUMO-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Envelope protein

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Envelope protein.

Molecular Weight

24.6 kDa

References & Citations

"Sequence and transcriptional analysis of the vaccinia virus HindIII I fragment."Schmitt J.F.C., Stunnenberg H.G.J. Virol. 62:1889-1897 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF647 conjugate, 0.1mg/mL
BNC470747-100 1x 100 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF647 conjugate, 0.1mg/mL
BNC472346-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF568 conjugate, 0.1mg/mL
BNC681862-100 1x 100 µL

CD79a (B-Cell Marker) (rIGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details