Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PLSCR5 sgRNA gene knockout kit - Lentiviral human PLSCR5 sgRNA gene knockout kit (100)
GTR15389497 1 Vial

Lentiviral human PLSCR5 sgRNA gene knockout kit - Lentiviral human PLSCR5 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse Interleukin-15 (IL-15) AssayLite™ Antibody (FITC Conjugate)
32200-05141 2x 75 µg

Mouse Interleukin-15 (IL-15) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
APH1A Polyclonal Antibody, Cy3 Conjugated
bs-4259R-Cy3 100 µL

APH1A Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Jagn1 (NM_001044272) Rat Tagged Lenti ORF Clone
RR204404L4 10 µg

Jagn1 (NM_001044272) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KA1 Rabbit monoclonal antibody
E43S40993 100 µL

KA1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
LOC688786 3'UTR GFP Stable Cell Line
TU261782 1.0 mL

LOC688786 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details