Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H2A.Z Antibody (RM215) [Alexa Fluor 750]
NBP3-26045AF750 0.1 mL

Rabbit Monoclonal Histone H2A.Z Antibody (RM215) [Alexa Fluor 750]

Sign In for Pricing
View Details
PerCP-Cyanine5.5 Anti-Mouse CD90.2 (30-H12)
MBS4165649-01 0.1 mg

PerCP-Cyanine5.5 Anti-Mouse CD90.2 (30-H12)

Sign In for Pricing
View Details
PerCP-Cyanine5.5 Anti-Mouse CD90.2 (30-H12)
MBS4165649-02 5x 0.1 mg

PerCP-Cyanine5.5 Anti-Mouse CD90.2 (30-H12)

Sign In for Pricing
View Details
FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (MaxLight 405) discontinued
246113-ML405 100 µL

FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Peptone Water
C39MM1027 500 g/Set

Peptone Water

Sign In for Pricing
View Details
BCL2L14 (Apoptosis Facilitator Bcl-2-like Protein 14, Bcl2-L-14, Apoptosis Regulator Bcl-G, BCLG) (PE)
MBS6156718-01 0.1 mL

BCL2L14 (Apoptosis Facilitator Bcl-2-like Protein 14, Bcl2-L-14, Apoptosis Regulator Bcl-G, BCLG) (PE)

Sign In for Pricing
View Details