Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Campneoside II
MBS5824436 Inquire

Campneoside II

Sign In for Pricing
View Details
BRAF35 (HMG20B) (NM_006339) Human Tagged Lenti ORF Clone
RC202444L3 10 µg

BRAF35 (HMG20B) (NM_006339) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal ORAI3 Antibody [mFluor Violet 610 SE]
NBP2-82013MFV610 0.1 mL

Rabbit Polyclonal ORAI3 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Lentiviral mouse Eef1g shRNA (UAS) - Lentiviral mouse Eef1g shRNA (UAS, GFP) plasmid
GTR15219430 1 Vial

Lentiviral mouse Eef1g shRNA (UAS) - Lentiviral mouse Eef1g shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Cig2 Antibody (CIG2 3A11/5) [Alexa Fluor 594]
NB100-2613AF594 0.1 mL

Mouse Monoclonal Cig2 Antibody (CIG2 3A11/5) [Alexa Fluor 594]

Sign In for Pricing
View Details
hsa-miR-7157-5p miRNA Agomir
MBS8313181-01 5 nmol

hsa-miR-7157-5p miRNA Agomir

Sign In for Pricing
View Details