Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRS 2159
sc-301175 5 mg

MRS 2159

Sign In for Pricing
View Details
Human TNFSF13B knockdown cell line
ABC-KD15857 1 Vial

Human TNFSF13B knockdown cell line

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 3 Putative membrane protein 047R (IIV3-047R), partial
MBS7074046 Inquire

Recombinant Invertebrate iridescent virus 3 Putative membrane protein 047R (IIV3-047R), partial

Sign In for Pricing
View Details
Dock11 Mouse Gene Knockout Kit (CRISPR)
KN504736 1 Kit

Dock11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAPGEF4 (Rap Guanine Nucleotide Exchange Factor 4, cAMP-regulated Guanine Nucleotide Exchange Factor II, cAMP-GEFII, CGEF2, Exchange Factor Directly Activated by cAMP 2, Exchange Protein Directly Activated by cAMP 2, EPAC 2, EPAC2, Nbla00496) (FITC)
132311-FITC 100 µL

RAPGEF4 (Rap Guanine Nucleotide Exchange Factor 4, cAMP-regulated Guanine Nucleotide Exchange Factor II, cAMP-GEFII, CGEF2, Exchange Factor Directly Activated by cAMP 2, Exchange Protein Directly Activated by cAMP 2, EPAC 2, EPAC2, Nbla00496) (FITC)

Sign In for Pricing
View Details
RhoA, B, C (GDP/GTP Binding Protein) (FITC) discontinued
R1998-01A-FITC 100 µL

RhoA, B, C (GDP/GTP Binding Protein) (FITC) discontinued

Sign In for Pricing
View Details