Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-1 (14F468)
sc-56036 50 µg - 0.5 mL

Caspase-1 (14F468)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)
MBS1279810-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)
MBS1279810-02 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)
MBS1279810-03 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)
MBS1279810-04 0.1 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)
MBS1279810-05 0.02 mg (Baculovirus)

Recombinant Streptococcus agalactiae serotype III Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details