Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIPES Buffer 1M, pH 6.0
41620038-2 250 mL

PIPES Buffer 1M, pH 6.0

Sign In for Pricing
View Details
APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4) (MaxLight 750) discontinued
123425-ML750 100 µL

APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
5-Methyltetrahydrofolic acid disodium salt
sc-214334A 10 mg

5-Methyltetrahydrofolic acid disodium salt

Sign In for Pricing
View Details
Olr287 sgRNA CRISPR Lentivector set (Rat)
K7178601 3x 1.0 µg

Olr287 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)
MBS6003362-01 0.2 mL

RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)

Sign In for Pricing
View Details
RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)
MBS6003362-02 5x 0.2 mL

RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)

Sign In for Pricing
View Details