Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P47 phox (Phospho-S359) Antibody
E38PA4111 100 µL

P47 phox (Phospho-S359) Antibody

Sign In for Pricing
View Details
DEFB104B Human Gene Knockout Kit (CRISPR)
KN424160 1 Kit

DEFB104B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
mmu-miR-467e miRNA Antagomir
MNM02142 2x 5.0 nmol

mmu-miR-467e miRNA Antagomir

Sign In for Pricing
View Details
POLR1B, NT (POLR1B, DNA-directed RNA polymerase I subunit RPA2, DNA-directed RNA polymerase I 135kD polypeptide) (MaxLight 550) discontinued
040251-ML550 100 µL

POLR1B, NT (POLR1B, DNA-directed RNA polymerase I subunit RPA2, DNA-directed RNA polymerase I 135kD polypeptide) (MaxLight 550) discontinued

Sign In for Pricing
View Details
C11orf88 sgRNA CRISPR Lentivector (Human) (Target 2)
K0288103 1.0 µg DNA

C11orf88 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-Mouse SHH Antibody (6D7), PerCP
MBS1586012-01 50 Tests

Anti-Mouse SHH Antibody (6D7), PerCP

Sign In for Pricing
View Details