Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Goat Anti-FMR1 (aa116-130) Antibody
AMM05935G 0.1 mg

Polyclonal Goat Anti-FMR1 (aa116-130) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HNF-3 beta/FoxA2 Antibody (OTI3C10) [Alexa Fluor 488]
NBP2-70904AF488 0.1 mL

Mouse Monoclonal HNF-3 beta/FoxA2 Antibody (OTI3C10) [Alexa Fluor 488]

Sign In for Pricing
View Details
Rat Anti-Mouse CD38-PE
31-1891-0.1 0.1 mg

Rat Anti-Mouse CD38-PE

Sign In for Pricing
View Details
Fam135a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4114808 1.0 µg DNA

Fam135a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MICA (NM_001289154) Human Tagged ORF Clone
RC236473 10 µg

MICA (NM_001289154) Human Tagged ORF Clone

Sign In for Pricing
View Details
NPPA (ANF, ANP, Atriopeptin, ATFB6, Atrial Natriuretic Factor, CDD-ANF, Cardionatrin, Natriuretic Peptides A, Prepronatriodilatin, Natriuretic Peptide A, PND)
215748 50 µg

NPPA (ANF, ANP, Atriopeptin, ATFB6, Atrial Natriuretic Factor, CDD-ANF, Cardionatrin, Natriuretic Peptides A, Prepronatriodilatin, Natriuretic Peptide A, PND)

Sign In for Pricing
View Details