Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZMYM6NB Double Nickase Plasmid (h)
sc-418875-NIC 20 µg

ZMYM6NB Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit
MBS2602560-01 48 Well

Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit

Sign In for Pricing
View Details
Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit
MBS2602560-02 96 Well

Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit

Sign In for Pricing
View Details
Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit
MBS2602560-03 5x 96 Well

Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit

Sign In for Pricing
View Details
Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit
MBS2602560-04 10x 96 Well

Chicken Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit

Sign In for Pricing
View Details
ATRX
PR374-6ml 6 mL

ATRX

Sign In for Pricing
View Details