Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100362984 3'UTR Luciferase Stable Cell Line
TU208535 1.0 mL

LOC100362984 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FBXL17 (NM_022824) Human Tagged ORF Clone Lentiviral Particle
RC219715L1V 200 µL

FBXL17 (NM_022824) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Potato Virus Y (PVY) Lateral Flow Assay Kit
E-PD-C002 25 Tests

Potato Virus Y (PVY) Lateral Flow Assay Kit

Sign In for Pricing
View Details
MRPL20 Human shRNA Plasmid Kit (Locus ID 55052)
TL303174 1 Kit

MRPL20 Human shRNA Plasmid Kit (Locus ID 55052)

Sign In for Pricing
View Details
Recombinant Encephalitozoon cuniculi UPF0329 protein ECU06_0050 (ECU06_0050)
MBS1487168-01 0.02 mg (E-Coli)

Recombinant Encephalitozoon cuniculi UPF0329 protein ECU06_0050 (ECU06_0050)

Sign In for Pricing
View Details
Recombinant Encephalitozoon cuniculi UPF0329 protein ECU06_0050 (ECU06_0050)
MBS1487168-02 0.1 mg (E-Coli)

Recombinant Encephalitozoon cuniculi UPF0329 protein ECU06_0050 (ECU06_0050)

Sign In for Pricing
View Details