Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FSBA Antibody (FSBA 2F5/5) [DyLight 405]
NB100-2656V 0.1 mL

Mouse Monoclonal FSBA Antibody (FSBA 2F5/5) [DyLight 405]

Sign In for Pricing
View Details
USP28, NT (Ubiquitin Carboxyl-terminal Hydrolase 28, Ubiquitin Thiolesterase 28, Ubiquitin-specific Processing Protease 28, Deubiquitinating Enzyme 28, KIAA1515) (MaxLight 490) discontinued
U4101-28D-ML490 100 µL

USP28, NT (Ubiquitin Carboxyl-terminal Hydrolase 28, Ubiquitin Thiolesterase 28, Ubiquitin-specific Processing Protease 28, Deubiquitinating Enzyme 28, KIAA1515) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Gprasp1 (BC058970) Mouse Tagged ORF Clone Lentiviral Particle
MR211303L3V 200 µL

Gprasp1 (BC058970) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-CDCA8 Polyclonal Antibody
MF-0070645-01 50 µL

Anti-CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CDCA8 Polyclonal Antibody
MF-0070645-02 100 µL

Anti-CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CDCA8 Polyclonal Antibody
MF-0070645-03 200 µL

Anti-CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details