Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF11A Protein Vector (Mouse) (pPB-C-His)
PV240266 500 ng

TNFRSF11A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CD13 (Aminopeptidase N) (MaxLight 750) discontinued
227400-ML750 100 µL

CD13 (Aminopeptidase N) (MaxLight 750) discontinued

Sign In for Pricing
View Details
B Raf (Phospho T401) (6C16) Rabbit Monoclonal Antibody
E28G2131 100 µL

B Raf (Phospho T401) (6C16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Vmn2r61 Protein Vector (Mouse) (pPM-C-His)
PV246297 500 ng

Vmn2r61 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Pigeon Dihydropyrimidinase-Related Protein 1 (CRMP1) ELISA Kit
MBS9945827 Inquire

Pigeon Dihydropyrimidinase-Related Protein 1 (CRMP1) ELISA Kit

Sign In for Pricing
View Details
PAK1 (p21 GTPase activated protein kinase 1) (MaxLight 650)
P2488-05A-ML650 100 µL

PAK1 (p21 GTPase activated protein kinase 1) (MaxLight 650)

Sign In for Pricing
View Details