Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBA2 Rabbit Polyclonal Antibody
TA313454 100 µL

APBA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-DDXl IHC Antibody, Affinity Purified
IHC-00132-T 2.5 µg

Rabbit anti-DDXl IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)
MBS1404036-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)
MBS1404036-02 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)
MBS1404036-03 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)
MBS1404036-04 0.1 mg (Yeast)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details