Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293, C-His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293-c-his.html

Purity

97.00

Smiles

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (A19-D707) (Accession)

Molecular Weight

Approximately 82.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-36α Protein
PM0043E2 20 µg

Recombinant Mouse IL-36α Protein

Sign In for Pricing
View Details
Phospho-MEK1 (Ser385) Polyclonal Antibody, APC-Cy7 Conjugated
bs-5411R-APC-Cy7 100 µL

Phospho-MEK1 (Ser385) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Goat Polyclonal Goat F(ab')2 anti-Human IgM Secondary Antibody [R-Phycoerythrin] (Pre-adsorbed)
NBP2-68535 0.5 mL

Goat Polyclonal Goat F(ab')2 anti-Human IgM Secondary Antibody [R-Phycoerythrin] (Pre-adsorbed)

Sign In for Pricing
View Details
SERTAD4 AAV Vector (Mouse) (CMV)
43512105 1 µg

SERTAD4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
L-Rhamnose Diethyl Dithioacetal
R1996-55G 2.5 g

L-Rhamnose Diethyl Dithioacetal

Sign In for Pricing
View Details
TARS1 (NM_152295) Human 3' UTR Clone
SC205156 10 µg

TARS1 (NM_152295) Human 3' UTR Clone

Sign In for Pricing
View Details