Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRA2/GDNFR-alpha-2, Human (HEK293, His)

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfra2-protein-human-hek-293-his.html

Purity

98.0

Smiles

SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS

Molecular Formula

2675 (Gene_ID) O00451-1 (S22-S441) (Accession)

Molecular Weight

Approximately 80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SorLA Antibody (3F2)
H00006653-M01 0.1 mg

Mouse Monoclonal SorLA Antibody (3F2)

Sign In for Pricing
View Details
HB pre-S1+S2
orb316790 1 mg

HB pre-S1+S2

Sign In for Pricing
View Details
APC anti-mouse CD194 (CCR4)
E16FMA194-100U 100 µg

APC anti-mouse CD194 (CCR4)

Sign In for Pricing
View Details
LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (APC)
MBS6166593-01 0.1 mL

LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (APC)

Sign In for Pricing
View Details
LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (APC)
MBS6166593-02 5x 0.1 mL

LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (APC)

Sign In for Pricing
View Details
Recombinant Human CLIP3 Protein
E30P6659 20 µg

Recombinant Human CLIP3 Protein

Sign In for Pricing
View Details